PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100177150021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 329aa    MW: 36615.3 Da    PI: 8.4814
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100177150021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.6e-31180235156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k+r++W+peLH++F++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Ote100177150021|100177150021 180 KARRCWSPELHRKFLQALQQLGGSHLATPKQIRELMKVDGLTNDEVKSHLQKYRLH 235
                                   68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.187177237IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-28178238IPR009057Homeodomain-like
SuperFamilySSF466893.33E-18178238IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-27180235IPR006447Myb domain, plants
PfamPF002495.6E-8182233IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MHRCQDYIHA LEDERRKIQV FQRELPLCLE LVTQAIEACK QQLSGSTTEY HLNGQSECSE  60
QTSSDAPVLE EFIPLKCGQE QESKKPTDID RESNNCKKSD WLRSVQLWNQ IPDPPSNEDS  120
TKKLAVVEVK RDGSGGAFHP FKKERSQIEV KRSVPAASTS SSAETGGNKK TDKEKEAQRK  180
ARRCWSPELH RKFLQALQQL GGSHLATPKQ IRELMKVDGL TNDEVKSHLQ KYRLHTRRPS  240
PSIQXXXXXX XXXXXAPQFV VVGGIWVPPE YAMATSGSGE AATATSNGIY APVAVLPTPL  300
RAKPQHSDSQ SHSPATSSST HTTTASQPY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070832.11e-146PREDICTED: uncharacterized protein LOC105156412
TrEMBLD7T9871e-135D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438